Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of CD3G monoclonal antibody (M01), clone 2A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CD3G monoclonal antibody (M01), clone 2A6
| Brand: | Abnova |
| Reference: | H00000917-M01 |
| Product name: | CD3G monoclonal antibody (M01), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD3G. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 917 |
| Gene name: | CD3G |
| Gene alias: | CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G |
| Gene description: | CD3g molecule, gamma (CD3-TCR complex) |
| Genbank accession: | NM_000073 |
| Immunogen: | CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN |
| Protein accession: | NP_000064 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |