Cart 211 Product Products 70 441,51 € (empty)
-
-
-
-
-
-
-
-
-
-
-
1 x ST18...259,07 € -
-
-
-
-
1 x FGF-2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x Histone...259,07 € -
1 x SR-3A...259,07 € -
-
-
-
-
-
-
1 x Stat1...259,07 € -
-
-
1 x Smad3...259,07 € -
-
-
-
-
-
1 x Phospho-PL...259,07 € -
1 x TGase2...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x Smad2/3...259,07 € -
1 x Glut5...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Smad3...259,07 € -
1 x SR-1E...259,07 € -
-
-
-
-
-
-
1 x Phospho-IR...259,07 € -
1 x GSK3α...259,07 € -
-
-
-
-
1 x DAN...259,07 € -
-
-
-
-
1 x Phospho-Pa...259,07 € -
1 x SMYD2...259,07 € -
-
-
-
1 x GRK 2...259,07 € -
-
-
1 x FGF-11...259,07 € -
-
-
-
-
-
-
-
1 x Snk...259,07 € -
-
-
-
-
-
-
-
-
-
1 x ZNRF2...259,07 € -
-
-
1 x CD201...259,07 € -
-
-
-
-
-
-
1 x Splicing...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x SMG7...259,07 € -
-
-
-
1 x Strad...259,07 € -
-
-
1 x Phospho-Hr...259,07 € -
1 x GSTT1/4...259,07 € -
1 x TCEAL6...259,07 € -
-
-
-
-
-
1 x FGF-17...259,07 € -
-
1 x BCSC-1...259,07 € -
-
-
-
-
-
-
1 x Smad3...259,07 € -
-
-
-
-
1 x Phospho-p2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x IRAK-M...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x Tetraspani...259,07 € -
-
-
-
-
1 x TAAR3...259,07 € -
-
-
No products
To be determined Shipping
70 441,51 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 211 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 70 441,51 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 70 441,51 €
Data sheet of CD3G polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CD3G polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000917-A01 |
| Product name: | CD3G polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CD3G. |
| Gene id: | 917 |
| Gene name: | CD3G |
| Gene alias: | CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G |
| Gene description: | CD3g molecule, gamma (CD3-TCR complex) |
| Genbank accession: | NM_000073 |
| Immunogen: | CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN |
| Protein accession: | NP_000064 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |