| Brand:  | Abnova | 
| Reference:  | H00000916-M04 | 
| Product name:  | CD3E monoclonal antibody (M04), clone 4C1 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant CD3E. | 
| Clone:  | 4C1 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 916 | 
| Gene name:  | CD3E | 
| Gene alias:  | FLJ18683|T3E|TCRE | 
| Gene description:  | CD3e molecule, epsilon (CD3-TCR complex) | 
| Genbank accession:  | BC049847 | 
| Immunogen:  | CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI | 
| Protein accession:  | AAH49847.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (46.09 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | CD3E monoclonal antibody (M04), clone 4C1 Western Blot analysis of CD3E expression in HeLa ( Cat # L013V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce | 
| Shipping condition:  | Dry Ice |