| Brand: | Abnova |
| Reference: | H00000916-M04 |
| Product name: | CD3E monoclonal antibody (M04), clone 4C1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CD3E. |
| Clone: | 4C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 916 |
| Gene name: | CD3E |
| Gene alias: | FLJ18683|T3E|TCRE |
| Gene description: | CD3e molecule, epsilon (CD3-TCR complex) |
| Genbank accession: | BC049847 |
| Immunogen: | CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
| Protein accession: | AAH49847.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CD3E monoclonal antibody (M04), clone 4C1 Western Blot analysis of CD3E expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |