| Brand: | Abnova |
| Reference: | H00000910-M06 |
| Product name: | CD1B monoclonal antibody (M06), clone 2E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD1B. |
| Clone: | 2E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 910 |
| Gene name: | CD1B |
| Gene alias: | CD1|CD1A|MGC125990|MGC125991|R1 |
| Gene description: | CD1b molecule |
| Genbank accession: | NM_001764 |
| Immunogen: | CD1B (NP_001755.1, 19 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY |
| Protein accession: | NP_001755.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CD1B is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |