| Brand:  | Abnova | 
| Reference:  | H00000902-M01 | 
| Product name:  | CCNH monoclonal antibody (M01), clone 1B8 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CCNH. | 
| Clone:  | 1B8 | 
| Isotype:  | IgG2a kappa | 
| Gene id:  | 902 | 
| Gene name:  | CCNH | 
| Gene alias:  | CAK|p34|p37 | 
| Gene description:  | cyclin H | 
| Genbank accession:  | BC005280 | 
| Immunogen:  | CCNH (AAH05280, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF | 
| Protein accession:  | AAH05280 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.73 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to CCNH on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair.Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura KI, Ogi T. Nat Genet. 2012 Apr 1. doi: 10.1038/ng.2229. [Epub ahead of print] |