CCND2 MaxPab rabbit polyclonal antibody (D01) View larger

CCND2 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCND2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr,IP

More info about CCND2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00000894-D01
Product name: CCND2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CCND2 protein.
Gene id: 894
Gene name: CCND2
Gene alias: KIAK0002|MGC102758
Gene description: cyclin D2
Genbank accession: NM_001759
Immunogen: CCND2 (NP_001750.1, 1 a.a. ~ 289 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Protein accession: NP_001750.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000894-D01-13-15-1.jpg
Application image note: Western Blot analysis of CCND2 expression in transfected 293T cell line (H00000894-T02) by CCND2 MaxPab polyclonal antibody.

Lane 1: CCND2 transfected lysate(33.10 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CCND2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart