Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCND2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about CCND2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00000894-B01P |
| Product name: | CCND2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CCND2 protein. |
| Gene id: | 894 |
| Gene name: | CCND2 |
| Gene alias: | KIAK0002|MGC102758 |
| Gene description: | cyclin D2 |
| Genbank accession: | NM_001759 |
| Immunogen: | CCND2 (NP_001750.1, 1 a.a. ~ 289 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL |
| Protein accession: | NP_001750.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCND2 expression in transfected 293T cell line (H00000894-T01) by CCND2 MaxPab polyclonal antibody. Lane 1: CCND2 transfected lysate(31.79 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation.Rangrez AY, Pott J, Kluge A, Frauen R, Stiebeling K, Hoppe P, Sossalla S, Frey N, Frank D. Biochim Biophys Acta. 2017 Jan 10;1864(4):634-644. |