Brand: | Abnova |
Reference: | H00000885-M02 |
Product name: | CCK monoclonal antibody (M02), clone 2A5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CCK. |
Clone: | 2A5 |
Isotype: | IgG2a Kappa |
Gene id: | 885 |
Gene name: | CCK |
Gene alias: | MGC117187 |
Gene description: | cholecystokinin |
Genbank accession: | BC008283 |
Immunogen: | CCK (AAH08283, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
Protein accession: | AAH08283 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |