| Brand: | Abnova |
| Reference: | H00000875-M07 |
| Product name: | CBS monoclonal antibody (M07), clone 5F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CBS. |
| Clone: | 5F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 875 |
| Gene name: | CBS |
| Gene alias: | HIP4 |
| Gene description: | cystathionine-beta-synthase |
| Genbank accession: | NM_000071 |
| Immunogen: | CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG |
| Protein accession: | NP_000062 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CBS is approximately 0.03ng/ml as a capture antibody. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |