| Brand:  | Abnova | 
| Reference:  | H00000875-M06 | 
| Product name:  | CBS monoclonal antibody (M06), clone 6A9 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CBS. | 
| Clone:  | 6A9 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 875 | 
| Gene name:  | CBS | 
| Gene alias:  | HIP4 | 
| Gene description:  | cystathionine-beta-synthase | 
| Genbank accession:  | NM_000071 | 
| Immunogen:  | CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG | 
| Protein accession:  | NP_000062 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged CBS is approximately 0.03ng/ml as a capture antibody. | 
| Applications:  | IHC-P,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap.Jiang H, Hurt KJ, Breen K, Stabler SP, Allen RH, Orlicky DJ, Maclean KN. Biol Open. 2015 Aug 14;4(9):1154-62. |