Brand: | Abnova |
Reference: | H00000875-M02 |
Product name: | CBS monoclonal antibody (M02), clone 3D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CBS. |
Clone: | 3D10 |
Isotype: | IgG2a Kappa |
Gene id: | 875 |
Gene name: | CBS |
Gene alias: | HIP4 |
Gene description: | cystathionine-beta-synthase |
Genbank accession: | NM_000071 |
Immunogen: | CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG |
Protein accession: | NP_000062 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CBS MaxPab rabbit polyclonal antibody. |
Applications: | IF,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |