Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CBR1 monoclonal antibody (M02), clone 4D12-1G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CBR1 monoclonal antibody (M02), clone 4D12-1G8
| Brand: | Abnova |
| Reference: | H00000873-M02 |
| Product name: | CBR1 monoclonal antibody (M02), clone 4D12-1G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CBR1. |
| Clone: | 4D12-1G8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 873 |
| Gene name: | CBR1 |
| Gene alias: | CBR|SDR21C1|hCBR1 |
| Gene description: | carbonyl reductase 1 |
| Genbank accession: | BC002511 |
| Immunogen: | CBR1 (AAH02511.1, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
| Protein accession: | AAH02511.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CBR1 monoclonal antibody (M02), clone 4D12-1G8 Western Blot analysis of CBR1 expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Functional characterization of the promoter of human carbonyl reductase 1 (CBR1). Role of XRE elements in mediating induction of CBR1 by ligands of the aryl hydrocarbon receptor.Lakhman SS, Chen X, Gonzalez-Covarrubias V, Schuetz EG, Blanco JG. Mol Pharmacol. 2007 Sep;72(3):734-43. Epub 2007 Jun 14. |