Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RUNX3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RUNX3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000864-A01 |
| Product name: | RUNX3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RUNX3. |
| Gene id: | 864 |
| Gene name: | RUNX3 |
| Gene alias: | AML2|CBFA3|FLJ34510|MGC16070|PEBP2aC |
| Gene description: | runt-related transcription factor 3 |
| Genbank accession: | NM_004350 |
| Immunogen: | RUNX3 (NP_004341, 194 a.a. ~ 279 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFP |
| Protein accession: | NP_004341 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RUNX3 polyclonal antibody (A01), Lot # 070226JCSa Western Blot analysis of RUNX3 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Brn3a/Pou4f1 regulates dorsal root ganglion sensory neuron specification and axonal projection into the spinal cord.Zou M, Li S, Klein WH, Xiang M. Dev Biol. 2012 Apr 15;364(2):114-27. Epub 2012 Feb 3. |