RUNX1 monoclonal antibody (M22), clone 3H7 View larger

RUNX1 monoclonal antibody (M22), clone 3H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX1 monoclonal antibody (M22), clone 3H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RUNX1 monoclonal antibody (M22), clone 3H7

Brand: Abnova
Reference: H00000861-M22
Product name: RUNX1 monoclonal antibody (M22), clone 3H7
Product description: Mouse monoclonal antibody raised against a partial recombinant RUNX1.
Clone: 3H7
Isotype: IgG2b Kappa
Gene id: 861
Gene name: RUNX1
Gene alias: AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB
Gene description: runt-related transcription factor 1
Genbank accession: NM_001754
Immunogen: RUNX1 (NP_001745, 376 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
Protein accession: NP_001745
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000861-M22-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RUNX1 monoclonal antibody (M22), clone 3H7 now

Add to cart