Brand: | Abnova |
Reference: | H00000861-M22 |
Product name: | RUNX1 monoclonal antibody (M22), clone 3H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX1. |
Clone: | 3H7 |
Isotype: | IgG2b Kappa |
Gene id: | 861 |
Gene name: | RUNX1 |
Gene alias: | AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB |
Gene description: | runt-related transcription factor 1 |
Genbank accession: | NM_001754 |
Immunogen: | RUNX1 (NP_001745, 376 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY |
Protein accession: | NP_001745 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |