| Brand:  | Abnova | 
| Reference:  | H00000861-M18 | 
| Product name:  | RUNX1 monoclonal antibody (M18), clone 3D7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RUNX1. | 
| Clone:  | 3D7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 861 | 
| Gene name:  | RUNX1 | 
| Gene alias:  | AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB | 
| Gene description:  | runt-related transcription factor 1 | 
| Genbank accession:  | NM_001754 | 
| Immunogen:  | RUNX1 (NP_001745, 376 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY | 
| Protein accession:  | NP_001745 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |