| Brand:  | Abnova | 
| Reference:  | H00000860-M09 | 
| Product name:  | RUNX2 monoclonal antibody (M09), clone 1C10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RUNX2. | 
| Clone:  | 1C10 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 860 | 
| Gene name:  | RUNX2 | 
| Gene alias:  | AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1 | 
| Gene description:  | runt-related transcription factor 2 | 
| Genbank accession:  | NM_001024630 | 
| Immunogen:  | RUNX2 (NP_001019801.1, 311 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS | 
| Protein accession:  | NP_001019801.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (41.14 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |