Brand: | Abnova |
Reference: | H00000860-M03 |
Product name: | RUNX2 monoclonal antibody (M03), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX2. |
Clone: | 1C10 |
Isotype: | IgG2a Kappa |
Gene id: | 860 |
Gene name: | RUNX2 |
Gene alias: | AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1 |
Gene description: | runt-related transcription factor 2 |
Genbank accession: | NM_004348 |
Immunogen: | RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA |
Protein accession: | NP_004339 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RUNX2 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |