RUNX2 monoclonal antibody (M02), clone 2B9 View larger

RUNX2 monoclonal antibody (M02), clone 2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX2 monoclonal antibody (M02), clone 2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about RUNX2 monoclonal antibody (M02), clone 2B9

Brand: Abnova
Reference: H00000860-M02
Product name: RUNX2 monoclonal antibody (M02), clone 2B9
Product description: Mouse monoclonal antibody raised against a partial recombinant RUNX2.
Clone: 2B9
Isotype: IgG2a Kappa
Gene id: 860
Gene name: RUNX2
Gene alias: AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1
Gene description: runt-related transcription factor 2
Genbank accession: NM_004348
Immunogen: RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Protein accession: NP_004339
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000860-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00000860-M02-1-11-1.jpg
Application image note: RUNX2 monoclonal antibody (M02), clone 2B9 Western Blot analysis of RUNX2 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RUNX2 monoclonal antibody (M02), clone 2B9 now

Add to cart