Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RUNX2 monoclonal antibody (M01), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RUNX2 monoclonal antibody (M01), clone 1D8
| Brand: | Abnova |
| Reference: | H00000860-M01 |
| Product name: | RUNX2 monoclonal antibody (M01), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX2. |
| Clone: | 1D8 |
| Isotype: | IgG2b |
| Gene id: | 860 |
| Gene name: | RUNX2 |
| Gene alias: | AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1 |
| Gene description: | runt-related transcription factor 2 |
| Genbank accession: | NM_004348 |
| Immunogen: | RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA |
| Protein accession: | NP_004339 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Runt-related transcription factor 2 (RUNX2) in human colon carcinoma: A potent prognostic factor associated with estrogen receptor.Sase T, Suzuki T, Miura K, Shiiba K, Sato I, Nakamura Y, Takagi K, Onodera Y, Miki Y, Watanabe M, Ishida K, Ohnuma S, Sasaki H, Sato R, Karasawa H, Shibata C, Unno M, Sasaki I, Sasano H. Int J Cancer. 2012 Mar 7. doi: 10.1002/ijc.27525. [Epub ahead of print] |