No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000859-Q01 |
Product name: | CAV3 (Human) Recombinant Protein (Q01) |
Product description: | Human CAV3 partial ORF ( NP_001225, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 859 |
Gene name: | CAV3 |
Gene alias: | LGMD1C|LQT9|MGC126100|MGC126101|MGC126129|VIP-21|VIP21 |
Gene description: | caveolin 3 |
Genbank accession: | NM_001234 |
Immunogen sequence/protein sequence: | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP |
Protein accession: | NP_001225 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Overexpression of caveolin-1 in adult T-cell leukemia.Sawada S, Ishikawa C, Tanji H, Nakachi S, Senba M, Okudaira T, Uchihara JN, Taira N, Ohshiro K, Yamada Y, Tanaka Y, Uezato H, Ohshima K, Sasai K, Burgering BM, Duc Dodon M, Fujii M, Sunakawa H, Mori N. Blood. 2010 Mar 18;115(11):2220-30. Epub 2010 Jan 8. |