| Brand:  | Abnova | 
| Reference:  | H00000844-M01 | 
| Product name:  | CASQ1 monoclonal antibody (M01), clone 1D7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CASQ1. | 
| Clone:  | 1D7 | 
| Isotype:  | IgG3 Kappa | 
| Gene id:  | 844 | 
| Gene name:  | CASQ1 | 
| Gene alias:  | CASQ|PDIB1 | 
| Gene description:  | calsequestrin 1 (fast-twitch, skeletal muscle) | 
| Genbank accession:  | NM_001231 | 
| Immunogen:  | CASQ1 (NP_001222, 29 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDE | 
| Protein accession:  | NP_001222 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged CASQ1 is 1 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |