No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000839-A01 |
Product name: | CASP6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CASP6. |
Gene id: | 839 |
Gene name: | CASP6 |
Gene alias: | MCH2 |
Gene description: | caspase 6, apoptosis-related cysteine peptidase |
Genbank accession: | NM_001226 |
Immunogen: | CASP6 (NP_001217, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGN |
Protein accession: | NP_001217 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |