No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000832-M03 |
Product name: | CAPZB monoclonal antibody (M03), clone 4H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPZB. |
Clone: | 4H8 |
Isotype: | IgG2a Kappa |
Gene id: | 832 |
Gene name: | CAPZB |
Gene alias: | CAPB|CAPPB|CAPZ|MGC104401|MGC129749|MGC129750 |
Gene description: | capping protein (actin filament) muscle Z-line, beta |
Genbank accession: | NM_004930 |
Immunogen: | CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
Protein accession: | NP_004921 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CAPZB monoclonal antibody (M03), clone 4H8 Western Blot analysis of CAPZB expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Functional analysis of beef tenderness.Guillemin N, Bonnet M, Jurie C, Picard B. J Proteomics. 2011 Aug 9. [Epub ahead of print] |