Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPS monoclonal antibody (M01), clone 4C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CAPS monoclonal antibody (M01), clone 4C6
| Brand: | Abnova |
| Reference: | H00000828-M01 |
| Product name: | CAPS monoclonal antibody (M01), clone 4C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPS. |
| Clone: | 4C6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 828 |
| Gene name: | CAPS |
| Gene alias: | CAPS1|MGC126562 |
| Gene description: | calcyphosine |
| Genbank accession: | NM_004058 |
| Immunogen: | CAPS (NP_004049, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSG |
| Protein accession: | NP_004049 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of CAPS over-expressed 293 cell line, cotransfected with CAPS Validated Chimera RNAi ( Cat # H00000828-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPS monoclonal antibody (M01), clone 4C6 (Cat # H00000828-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Novel Biomarkers in Pediatric Primitive Neuroectodermal Tumors and Ependymomas by Proteome-Wide Analysis.de Bont JM, den Boer ML, Kros JM, Passier MM, Reddingius RE, Smitt PA, Luider TM, Pieters R. J Neuropathol Exp Neurol. 2007 Jun;66(6):505-16. |