No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00000820-B03P |
Product name: | CAMP purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CAMP protein. |
Gene id: | 820 |
Gene name: | CAMP |
Gene alias: | CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37 |
Gene description: | cathelicidin antimicrobial peptide |
Genbank accession: | BC055089 |
Immunogen: | CAMP (AAH55089, 31 a.a. ~ 170 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | QVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Protein accession: | AAH55089 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CAMP expression in transfected 293T cell line (H00000820-T01) by CAMP MaxPab polyclonal antibody. Lane 1: CAMP transfected lysate(18.81 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |