Brand: | Abnova |
Reference: | H00000815-M05 |
Product name: | CAMK2A monoclonal antibody (M05), clone 1C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CAMK2A. |
Clone: | 1C6 |
Isotype: | IgG2a Kappa |
Gene id: | 815 |
Gene name: | CAMK2A |
Gene alias: | CAMKA|KIAA0968 |
Gene description: | calcium/calmodulin-dependent protein kinase II alpha |
Genbank accession: | BC040457 |
Immunogen: | CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV |
Protein accession: | AAH40457 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CAMK2A is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |