CAMK2A monoclonal antibody (M02), clone 1H7 View larger

CAMK2A monoclonal antibody (M02), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAMK2A monoclonal antibody (M02), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CAMK2A monoclonal antibody (M02), clone 1H7

Brand: Abnova
Reference: H00000815-M02
Product name: CAMK2A monoclonal antibody (M02), clone 1H7
Product description: Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 815
Gene name: CAMK2A
Gene alias: CAMKA|KIAA0968
Gene description: calcium/calmodulin-dependent protein kinase II alpha
Genbank accession: BC040457
Immunogen: CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
Protein accession: AAH40457
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000815-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000815-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CAMK2A is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CAMK2A monoclonal antibody (M02), clone 1H7 now

Add to cart