Brand: | Abnova |
Reference: | H00000810-M04 |
Product name: | CALML3 monoclonal antibody (M04), clone 2A11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CALML3. |
Clone: | 2A11 |
Isotype: | IgG2b Kappa |
Gene id: | 810 |
Gene name: | CALML3 |
Gene alias: | CLP |
Gene description: | calmodulin-like 3 |
Genbank accession: | BC031889 |
Immunogen: | CALML3 (AAH31889, 1 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK |
Protein accession: | AAH31889 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CALML3 is approximately 0.1ng/ml as a capture antibody. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |