Brand: | Abnova |
Reference: | H00000808-M11 |
Product name: | CALM3 monoclonal antibody (M11), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CALM3. |
Clone: | 1E2 |
Isotype: | IgG1 Kappa |
Gene id: | 808 |
Gene name: | CALM3 |
Gene alias: | PHKD|PHKD3 |
Gene description: | calmodulin 3 (phosphorylase kinase, delta) |
Genbank accession: | NM_005184 |
Immunogen: | CALM3 (NP_005175.2, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | INEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
Protein accession: | NP_005175.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CALM3 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |