| Brand: | Abnova |
| Reference: | H00000799-M01 |
| Product name: | CALCR monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CALCR. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 799 |
| Gene name: | CALCR |
| Gene alias: | CRT|CTR|CTR1 |
| Gene description: | calcitonin receptor |
| Genbank accession: | NM_001742 |
| Immunogen: | CALCR (NP_001733.1, 394 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA |
| Protein accession: | NP_001733.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CALCR is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of the calcitonin receptor in osteoarthritic chondrocytes.Segovia-Silvestre T, Bonnefond C, Sondergaard BC, Christensen T, Karsdal MA, Bay-Jensen AC. BMC Res Notes. 2011 Oct 13;4(1):407. |