| Brand:  | Abnova | 
| Reference:  | H00000799-M01 | 
| Product name:  | CALCR monoclonal antibody (M01), clone 2F7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CALCR. | 
| Clone:  | 2F7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 799 | 
| Gene name:  | CALCR | 
| Gene alias:  | CRT|CTR|CTR1 | 
| Gene description:  | calcitonin receptor | 
| Genbank accession:  | NM_001742 | 
| Immunogen:  | CALCR (NP_001733.1, 394 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA | 
| Protein accession:  | NP_001733.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (34.65 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged CALCR is approximately 0.03ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Identification of the calcitonin receptor in osteoarthritic chondrocytes.Segovia-Silvestre T, Bonnefond C, Sondergaard BC, Christensen T, Karsdal MA, Bay-Jensen AC. BMC Res Notes. 2011 Oct 13;4(1):407. |