Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00000796-M01 |
Product name: | CALCA monoclonal antibody (M01), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CALCA. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 796 |
Gene name: | CALCA |
Gene alias: | CALC1|CGRP|CGRP-I|CGRP1|CT|KC|MGC126648 |
Gene description: | calcitonin-related polypeptide alpha |
Genbank accession: | NM_001741 |
Immunogen: | CALCA (NP_001732, 52 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN |
Protein accession: | NP_001732 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CALCA expression in transfected 293T cell line by CALCA monoclonal antibody (M01), clone 4B10. Lane 1: CALCA transfected lysate(15.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |