View larger

CALCA polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of CALCA polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00000796-A01
Product name:	CALCA polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant CALCA.
Gene id:	796
Gene name:	CALCA
Gene alias:	CALC1\|CGRP\|CGRP-I\|CGRP1\|CT\|KC\|MGC126648
Gene description:	calcitonin-related polypeptide alpha
Genbank accession:	NM_001741
Immunogen:	CALCA (NP_001732, 52 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
Protein accession:	NP_001732
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.01 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice