CALB1 monoclonal antibody (M01), clone 1F6 View larger

CALB1 monoclonal antibody (M01), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CALB1 monoclonal antibody (M01), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CALB1 monoclonal antibody (M01), clone 1F6

Brand: Abnova
Reference: H00000793-M01
Product name: CALB1 monoclonal antibody (M01), clone 1F6
Product description: Mouse monoclonal antibody raised against a full-length recombinant CALB1.
Clone: 1F6
Isotype: IgG2a Kappa
Gene id: 793
Gene name: CALB1
Gene alias: CALB
Gene description: calbindin 1, 28kDa
Genbank accession: NM_004929.2
Immunogen: CALB1 (NP_004920.1, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Protein accession: NP_004920.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000793-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000793-M01-13-15-1.jpg
Application image note: Western Blot analysis of CALB1 expression in transfected 293T cell line by CALB1 monoclonal antibody (M01), clone 1F6.

Lane 1: CALB1 transfected lysate (Predicted MW: 30 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CALB1 monoclonal antibody (M01), clone 1F6 now

Add to cart