Brand: | Abnova |
Reference: | H00000783-M01 |
Product name: | CACNB2 monoclonal antibody (M01), clone 6C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNB2. |
Clone: | 6C1 |
Isotype: | IgG1 Kappa |
Gene id: | 783 |
Gene name: | CACNB2 |
Gene alias: | CACNLB2|CAVB2|FLJ23743|MYSB |
Gene description: | calcium channel, voltage-dependent, beta 2 subunit |
Genbank accession: | NM_201596 |
Immunogen: | CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
Protein accession: | NP_963890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | CACNB2 monoclonal antibody (M01), clone 6C1 Western Blot analysis of CACNB2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |