| Brand:  | Abnova | 
| Reference:  | H00000782-M01 | 
| Product name:  | CACNB1 monoclonal antibody (M01), clone 1G6 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CACNB1. | 
| Clone:  | 1G6 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 782 | 
| Gene name:  | CACNB1 | 
| Gene alias:  | CAB1|CACNLB1|CCHLB1|MGC41896 | 
| Gene description:  | calcium channel, voltage-dependent, beta 1 subunit | 
| Genbank accession:  | NM_000723 | 
| Immunogen:  | CACNB1 (NP_000714, 500 a.a. ~ 598 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR | 
| Protein accession:  | NP_000714 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi ( Cat # H00000782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody (M01), clone 1G6 (Cat # H00000782-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. | 
| Applications:  | ELISA,WB-Re,WB-Tr,RNAi-Ab | 
| Shipping condition:  | Dry Ice | 
| Publications:  | The {beta}1 subunit of L-type voltage-gated Ca2+ channels independently binds to and inhibits the gating of large-conductance Ca2+-activated K+ channels.Zou S, Jha S, Kim EY, Dryer SE. Mol Pharmacol. 2008 Feb;73(2):369-78. Epub 2007 Nov 7. |