Brand: | Abnova |
Reference: | H00000778-M01J |
Product name: | CACNA1F monoclonal antibody (M01J), clone 3B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNA1F. |
Clone: | 3B2 |
Isotype: | IgG3 Kappa |
Gene id: | 778 |
Gene name: | CACNA1F |
Gene alias: | AIED|COD3|CORDX|CORDX3|CSNB2|CSNB2A|CSNBX2|Cav1.4|JM8|JMC8|OA2 |
Gene description: | calcium channel, voltage-dependent, L type, alpha 1F subunit |
Genbank accession: | NM_005183 |
Immunogen: | CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL |
Protein accession: | NP_005174 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CACNA1F is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |