CACNA1F monoclonal antibody (M01J), clone 3B2 View larger

CACNA1F monoclonal antibody (M01J), clone 3B2

New product

504,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNA1F monoclonal antibody (M01J), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CACNA1F monoclonal antibody (M01J), clone 3B2

Brand: Abnova
Reference: H00000778-M01J
Product name: CACNA1F monoclonal antibody (M01J), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant CACNA1F.
Clone: 3B2
Isotype: IgG3 Kappa
Gene id: 778
Gene name: CACNA1F
Gene alias: AIED|COD3|CORDX|CORDX3|CSNB2|CSNB2A|CSNBX2|Cav1.4|JM8|JMC8|OA2
Gene description: calcium channel, voltage-dependent, L type, alpha 1F subunit
Genbank accession: NM_005183
Immunogen: CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
Protein accession: NP_005174
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000778-M01J-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000778-M01J-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CACNA1F is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CACNA1F monoclonal antibody (M01J), clone 3B2 now

Add to cart