| Brand: | Abnova |
| Reference: | H00000778-M01C |
| Product name: | CACNA1F monoclonal antibody (M01C), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNA1F. |
| Clone: | 3B2 |
| Isotype: | IgG3 Kappa |
| Gene id: | 778 |
| Gene name: | CACNA1F |
| Gene alias: | AIED|COD3|CORDX|CORDX3|CSNB2|CSNB2A|CSNBX2|Cav1.4|JM8|JMC8|OA2 |
| Gene description: | calcium channel, voltage-dependent, L type, alpha 1F subunit |
| Genbank accession: | NM_005183 |
| Immunogen: | CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL |
| Protein accession: | NP_005174 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |