| Brand:  | Abnova | 
| Reference:  | H00000767-M01 | 
| Product name:  | CA8 monoclonal antibody (M01), clone 1F7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CA8. | 
| Clone:  | 1F7 | 
| Isotype:  | IgG3 Kappa | 
| Gene id:  | 767 | 
| Gene name:  | CA8 | 
| Gene alias:  | CA-VIII|CALS|CARP|MGC120502|MGC99509 | 
| Gene description:  | carbonic anhydrase VIII | 
| Genbank accession:  | NM_004056 | 
| Immunogen:  | CA8 (NP_004047, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME | 
| Protein accession:  | NP_004047 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | CA8 monoclonal antibody (M01), clone 1F7 Western Blot analysis of CA8 expression in A-549 ( Cat # L025V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |