Brand: | Abnova |
Reference: | H00000766-M06 |
Product name: | CA7 monoclonal antibody (M06), clone 3B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CA7. |
Clone: | 3B7 |
Isotype: | IgG1 Kappa |
Gene id: | 766 |
Gene name: | CA7 |
Gene alias: | CAVII |
Gene description: | carbonic anhydrase VII |
Genbank accession: | NM_005182 |
Immunogen: | CA7 (NP_005173, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH* |
Protein accession: | NP_005173 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CA7 monoclonal antibody (M06), clone 3B7 Western Blot analysis of CA7 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |