Cart 18 Product Products 6 617,76 € (empty)
No products
To be determined Shipping
6 617,76 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 617,76 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 617,76 €
Data sheet of CA4 monoclonal antibody (M08), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about CA4 monoclonal antibody (M08), clone 4G6
| Brand: | Abnova |
| Reference: | H00000762-M08 |
| Product name: | CA4 monoclonal antibody (M08), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CA4. |
| Clone: | 4G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 762 |
| Gene name: | CA4 |
| Gene alias: | CAIV|Car4|RP17 |
| Gene description: | carbonic anhydrase IV |
| Genbank accession: | NM_000717 |
| Immunogen: | CA4 (NP_000708.1, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGS |
| Protein accession: | NP_000708.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CA4 monoclonal antibody (M08), clone 4G6. Western Blot analysis of CA4 expression in A-431. |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |