No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00000762-M08 |
Product name: | CA4 monoclonal antibody (M08), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CA4. |
Clone: | 4G6 |
Isotype: | IgG2a Kappa |
Gene id: | 762 |
Gene name: | CA4 |
Gene alias: | CAIV|Car4|RP17 |
Gene description: | carbonic anhydrase IV |
Genbank accession: | NM_000717 |
Immunogen: | CA4 (NP_000708.1, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGS |
Protein accession: | NP_000708.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CA4 monoclonal antibody (M08), clone 4G6. Western Blot analysis of CA4 expression in A-431. |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |