| Brand:  | Abnova | 
| Reference:  | H00000761-M02 | 
| Product name:  | CA3 monoclonal antibody (M02), clone 4A12-1A3 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant CA3. | 
| Clone:  | 4A12-1A3 | 
| Isotype:  | IgG1 kappa | 
| Gene id:  | 761 | 
| Gene name:  | CA3 | 
| Gene alias:  | CAIII|Car3 | 
| Gene description:  | carbonic anhydrase III, muscle specific | 
| Genbank accession:  | BC004897 | 
| Immunogen:  | CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK | 
| Protein accession:  | AAH04897 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (54.34 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling.Lindskog C, Linne J, Fagerberg L, Hallstrom BM, Sundberg CJ, Lindholm M, Huss M, Kampf C, Choi H, Liem DA, Ping P, Varemo L, Mardinoglu A, Nielsen J, Larsson E, Ponten F, Uhlen M. BMC Genomics. 2015 Jun 25;16(1):475. |