Brand: | Abnova |
Reference: | H00000759-M10 |
Product name: | CA1 monoclonal antibody (M10), clone 1F1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CA1. |
Clone: | 1F1 |
Isotype: | IgG2b Kappa |
Gene id: | 759 |
Gene name: | CA1 |
Gene alias: | Car1 |
Gene description: | carbonic anhydrase I |
Genbank accession: | BC027890 |
Immunogen: | CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
Protein accession: | AAH27890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CA1 monoclonal antibody (M10), clone 1F1. Western Blot analysis of CA1 expression in human lung cancer. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |