| Brand: | Abnova |
| Reference: | H00000759-M10 |
| Product name: | CA1 monoclonal antibody (M10), clone 1F1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CA1. |
| Clone: | 1F1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 759 |
| Gene name: | CA1 |
| Gene alias: | Car1 |
| Gene description: | carbonic anhydrase I |
| Genbank accession: | BC027890 |
| Immunogen: | CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Protein accession: | AAH27890 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CA1 monoclonal antibody (M10), clone 1F1. Western Blot analysis of CA1 expression in human lung cancer. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |