No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ti,S-ELISA,ELISA,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00000759-M07 | 
| Product name: | CA1 monoclonal antibody (M07), clone 7G12 | 
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CA1. | 
| Clone: | 7G12 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 759 | 
| Gene name: | CA1 | 
| Gene alias: | Car1 | 
| Gene description: | carbonic anhydrase I | 
| Genbank accession: | BC027890 | 
| Immunogen: | CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF | 
| Protein accession: | AAH27890 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | CA1 monoclonal antibody (M07), clone 7G12. Western Blot analysis of CA1 expression in human pancreas. | 
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Tr | 
| Shipping condition: | Dry Ice |