View larger

MPPED1 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of MPPED1 purified MaxPab mouse polyclonal antibody (B02P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human,Rat
Host species	Mouse
Applications	WB-Ti,IHC-P,WB-Tr

More info about MPPED1 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00000758-B02P
Product name:	MPPED1 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human MPPED1 protein.
Gene id:	758
Gene name:	MPPED1
Gene alias:	239AB\|C22orf1\|FAM1A\|MGC88045
Gene description:	metallophosphoesterase domain containing 1
Genbank accession:	NM_001585.2
Immunogen:	MPPED1 (NP_001576.3, 1 a.a. ~ 326 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Protein accession:	NP_001576.3
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Rat
Application image:
Application image note:	Western Blot analysis of MPPED1 expression in transfected 293T cell line (H00000758-T02) by MPPED1 MaxPab polyclonal antibody. Lane 1: MPPED1 transfected lysate(35.86 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,IHC-P,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy MPPED1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart