| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000758-B02 |
| Product name: | MPPED1 MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MPPED1 protein. |
| Gene id: | 758 |
| Gene name: | MPPED1 |
| Gene alias: | 239AB|C22orf1|FAM1A|MGC88045 |
| Gene description: | metallophosphoesterase domain containing 1 |
| Genbank accession: | NM_001585.2 |
| Immunogen: | MPPED1 (NP_001576.3, 1 a.a. ~ 326 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS |
| Protein accession: | NP_001576.3 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MPPED1 expression in transfected 293T cell line (H00000758-T02) by MPPED1 MaxPab polyclonal antibody. Lane 1: MPPED1 transfected lysate(35.86 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |