Cart 55 Product Products 20 442,20 € (empty)
No products
To be determined Shipping
20 442,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 55 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 442,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 442,20 €
Data sheet of PTTG1IP monoclonal antibody (M04), clone 4C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PTTG1IP monoclonal antibody (M04), clone 4C11
| Brand: | Abnova |
| Reference: | H00000754-M04 |
| Product name: | PTTG1IP monoclonal antibody (M04), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PTTG1IP. |
| Clone: | 4C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 754 |
| Gene name: | PTTG1IP |
| Gene alias: | C21orf1|C21orf3|PBF |
| Gene description: | pituitary tumor-transforming 1 interacting protein |
| Genbank accession: | BC020983 |
| Immunogen: | PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN |
| Protein accession: | AAH20983 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11. Lane 1: PTTG1IP transfected lysate(20.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |