PTTG1IP monoclonal antibody (M04), clone 4C11 View larger

PTTG1IP monoclonal antibody (M04), clone 4C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTTG1IP monoclonal antibody (M04), clone 4C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PTTG1IP monoclonal antibody (M04), clone 4C11

Brand: Abnova
Reference: H00000754-M04
Product name: PTTG1IP monoclonal antibody (M04), clone 4C11
Product description: Mouse monoclonal antibody raised against a full-length recombinant PTTG1IP.
Clone: 4C11
Isotype: IgG2a Kappa
Gene id: 754
Gene name: PTTG1IP
Gene alias: C21orf1|C21orf3|PBF
Gene description: pituitary tumor-transforming 1 interacting protein
Genbank accession: BC020983
Immunogen: PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Protein accession: AAH20983
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000754-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000754-M04-13-15-1.jpg
Application image note: Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11.

Lane 1: PTTG1IP transfected lysate(20.3 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PTTG1IP monoclonal antibody (M04), clone 4C11 now

Add to cart