Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MPPED2 monoclonal antibody (M01A), clone 2G1-1B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about MPPED2 monoclonal antibody (M01A), clone 2G1-1B7
| Brand: | Abnova |
| Reference: | H00000744-M01A |
| Product name: | MPPED2 monoclonal antibody (M01A), clone 2G1-1B7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MPPED2. |
| Clone: | 2G1-1B7 |
| Isotype: | IgM kappa |
| Gene id: | 744 |
| Gene name: | MPPED2 |
| Gene alias: | 239FB|C11orf8|D11S302E|FAM1B|Hs.46638|dJ1024C24.1|dJ873F21.1 |
| Gene description: | metallophosphoesterase domain containing 2 |
| Genbank accession: | BC031582 |
| Immunogen: | MPPED2 (AAH31582, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
| Protein accession: | AAH31582 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MPPED2 expression in transfected 293T cell line by C11orf8 monoclonal antibody (M01A), clone 2G1-1B7. Lane 1: MPPED2 transfected lysate(33.81 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |