| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000744-B01P |
| Product name: | MPPED2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MPPED2 protein. |
| Gene id: | 744 |
| Gene name: | MPPED2 |
| Gene alias: | 239FB|C11orf8|D11S302E|FAM1B|Hs.46638|dJ1024C24.1|dJ873F21.1 |
| Gene description: | metallophosphoesterase domain containing 2 |
| Genbank accession: | NM_001584 |
| Immunogen: | MPPED2 (NP_001575.1, 1 a.a. ~ 294 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
| Protein accession: | NP_001575.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MPPED2 expression in transfected 293T cell line (H00000744-T01) by MPPED2 MaxPab polyclonal antibody. Lane 1: MPPED2 transfected lysate(32.34 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |