No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00000741-M05 |
Product name: | ZNHIT2 monoclonal antibody (M05), clone 4G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNHIT2. |
Clone: | 4G11 |
Isotype: | IgG2a Kappa |
Gene id: | 741 |
Gene name: | ZNHIT2 |
Gene alias: | C11orf5|FON|MGC120285|MGC120286 |
Gene description: | zinc finger, HIT type 2 |
Genbank accession: | NM_014205 |
Immunogen: | ZNHIT2 (NP_055020.1, 274 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC |
Protein accession: | NP_055020.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ZNHIT2 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |