Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 279,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 279,00 €
Data sheet of ZNHIT2 monoclonal antibody (M05), clone 4G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ZNHIT2 monoclonal antibody (M05), clone 4G11
| Brand: | Abnova |
| Reference: | H00000741-M05 |
| Product name: | ZNHIT2 monoclonal antibody (M05), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNHIT2. |
| Clone: | 4G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 741 |
| Gene name: | ZNHIT2 |
| Gene alias: | C11orf5|FON|MGC120285|MGC120286 |
| Gene description: | zinc finger, HIT type 2 |
| Genbank accession: | NM_014205 |
| Immunogen: | ZNHIT2 (NP_055020.1, 274 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC |
| Protein accession: | NP_055020.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZNHIT2 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |