| Brand: | Abnova |
| Reference: | H00000734-M02 |
| Product name: | C8orf1 monoclonal antibody (M02), clone 3E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant C8orf1. |
| Clone: | 3E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 734 |
| Gene name: | OSGIN2 |
| Gene alias: | C8orf1|hT41 |
| Gene description: | oxidative stress induced growth inhibitor family member 2 |
| Genbank accession: | BC031054 |
| Immunogen: | C8orf1 (AAH31054, 398 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGDGIA |
| Protein accession: | AAH31054 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |